PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G087900.2
Common NamePOPTR_0001s10970g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 955aa    MW: 104883 Da    PI: 5.9042
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G087900.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.7e-29576627152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek isle+l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Potri.001G087900.2 576 AEKMISLEVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 627
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.78562647IPR003035RWP-RK domain
PfamPF020426.1E-26580627IPR003035RWP-RK domain
SuperFamilySSF542775.89E-21851942No hitNo description
Gene3DG3DSA:3.10.20.2403.0E-25858939No hitNo description
PROSITE profilePS5174520.353858940IPR000270PB1 domain
SMARTSM006661.4E-23858940IPR000270PB1 domain
CDDcd064073.23E-34859939No hitNo description
PfamPF005644.0E-16859939IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 955 aa     Download sequence    Send to blast
MPEPTEVGGG GESEGRKSME LDLDLDSSWP LDQISFISSN PMSTFLISSS NEQPCSPLWA  60
FSDAADDRLL AAAAGGGQAS SSFVGGLRLS DNPIVLTCNP NSVTESKGEN DDNSKLPSPF  120
LGLMPIDNPD GYCIIKERMT RALRHFKEST EQHILAQVWA PVKNGGRYAL TTSGQPFVID  180
PHSNGLHQYR MVSLMYKFSV DGESDGELGL PGRVFRQKLP EWTPNVQYYS SKEYSRLDHA  240
LHYNVRGTVA LPVFEPSGQS CVGVVELIMT SQKINYAPEV DKVCKALEAV DLKSSEILDP  300
PSTQICNEGR QNALAEILEI LTMVCETHKL PLAQTWVPCM HRSVLAYGGG LKKSCTSFDG  360
SCNGQVCMST TDVAFYVVDA HMWGFREACL EHHLQKGQGV AGRAFFSHNL CFCPDITQFC  420
KTEYPLVHYA RMFGLTSCFA ICLRSSYTGD DDYILEFFLP PSFTDSREWK TLLGSILAIM  480
KQDFQSLQVA SGMDLEEEEG FVEMIQVSTN GRLDLRLECI QIPQSTKSPP DDNALLNGPI  540
VQIYPEKKQL MLDLDVIKNG GKKETKKPKE RKRGKAEKMI SLEVLQQYFT GSLKDAAKSL  600
GVCPTTMKRI CRQHGISRWP SRKIKKVNRS LSKLKRVIES VQGTEGAFST SSLPVAVGTI  660
SWPPNLNGRN QQNSPNSKSP EHHGDKNGSP TCRTPGSDVK AELGTGSNRS KTRGGSRGES  720
AGTPTSHGSC QGCPENESAP AKDPSVSPVH ERCIKAGGSP ELVLQQTREL NLSAAYSIPD  780
AFFATEAQEQ FGGMLIEDTG SSKDLSNLCP AMADAIVDER FPESKWTDPP SSDINPTQMI  840
AALSIAMPHV TSRQEMNSVT IKATYREDMI RFRISLSSGI AKLKEEVAKR LRLEVGTFDI  900
KYLDDDHEWI LIARDADLHE CMDVSRSSNS NMIRVSVHDA NANLGSSCES TWEI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299449.10.0RWP-RK domain-containing family protein
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLB9GL230.0B9GL23_POPTR; RWP-RK domain-containing family protein
STRINGPOPTR_0001s10970.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7